ZNF704 polyclonal antibody
  • ZNF704 polyclonal antibody

ZNF704 polyclonal antibody

Ref: AB-PAB21673
ZNF704 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF704.
Información adicional
Size 100 uL
Gene Name ZNF704
Gene Alias FLJ16218|Gig1
Gene Description zinc finger protein 704
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHHPVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF704.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 619279
Iso type IgG

Enviar un mensaje


ZNF704 polyclonal antibody

ZNF704 polyclonal antibody