Ver mas grande
OR2K2 polyclonal antibody
AB-PAB21671
Producto nuevo
OR2K2 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | OR2K2 |
| Gene Alias | HSHTPCRH06|HTPCRH06|MGC133152|OR2AN1P|OR2AR1P |
| Gene Description | olfactory receptor, family 2, subfamily K, member 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human OR2K2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 26248 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant OR2K2.