FAM75E1 polyclonal antibody
  • FAM75E1 polyclonal antibody

FAM75E1 polyclonal antibody

Ref: AB-PAB21669
FAM75E1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM75E1.
Información adicional
Size 100 uL
Gene Name FAM75E1
Gene Alias C9orf79
Gene Description family with sequence similarity 75, member E1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSEAFPTGHKGRGCSQPPTCSLVGRTWQSRTVLESGKPKPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRALQVLSIGSQWARAEDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM75E1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286234
Iso type IgG

Enviar un mensaje


FAM75E1 polyclonal antibody

FAM75E1 polyclonal antibody