TRIM41 polyclonal antibody
  • TRIM41 polyclonal antibody

TRIM41 polyclonal antibody

Ref: AB-PAB21661
TRIM41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIM41.
Información adicional
Size 100 uL
Gene Name TRIM41
Gene Alias MGC1127|MGC31991|RINCK
Gene Description tripartite motif-containing 41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIM41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90933
Iso type IgG

Enviar un mensaje


TRIM41 polyclonal antibody

TRIM41 polyclonal antibody