NXT2 polyclonal antibody
  • NXT2 polyclonal antibody

NXT2 polyclonal antibody

Ref: AB-PAB21660
NXT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NXT2.
Información adicional
Size 100 uL
Gene Name NXT2
Gene Alias P15-2
Gene Description nuclear transport factor 2-like export factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NXT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55916
Iso type IgG

Enviar un mensaje


NXT2 polyclonal antibody

NXT2 polyclonal antibody