CAMSAP1 polyclonal antibody
  • CAMSAP1 polyclonal antibody

CAMSAP1 polyclonal antibody

Ref: AB-PAB21656
CAMSAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CAMSAP1.
Información adicional
Size 100 uL
Gene Name CAMSAP1
Gene Alias DKFZp434F195|DKFZp434G2311|FLJ31228|MGC163452|PRO2405|bA100C15.1
Gene Description calmodulin regulated spectrin-associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAMSAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157922
Iso type IgG

Enviar un mensaje


CAMSAP1 polyclonal antibody

CAMSAP1 polyclonal antibody