Ver mas grande
VSTM2A polyclonal antibody
AB-PAB21652
Producto nuevo
VSTM2A polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | VSTM2A |
| Gene Alias | MGC33530|VSTM2 |
| Gene Description | V-set and transmembrane domain containing 2A |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IHC-P |
| Immunogen Prot. Seq | KFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPEDLDPGAEGAGAQVELLPDRDPDSDGTKISTVK |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human VSTM2A. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 222008 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant VSTM2A.