C9orf93 polyclonal antibody Ver mas grande

C9orf93 polyclonal antibody

AB-PAB21651

Producto nuevo

C9orf93 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name C9orf93
Gene Alias DKFZp686P12113|FLJ39267|FLJ46740|MGC50805|bA536D16.1|bA778P13.1
Gene Description chromosome 9 open reading frame 93
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASTRIMTLEKEMTSHRSHIAALKSELHTACLRENASLQSIGSRDHSNLSIPSRAPLPADTTGIGDFLPLKAELDTTYTFLKETFINTVPHALTSSHSSPVTMSANANRPTQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf93.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203238
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant C9orf93.

Consulta sobre un producto

C9orf93 polyclonal antibody

C9orf93 polyclonal antibody