FAM132A polyclonal antibody
  • FAM132A polyclonal antibody

FAM132A polyclonal antibody

Ref: AB-PAB21646
FAM132A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM132A.
Información adicional
Size 100 uL
Gene Name FAM132A
Gene Alias C1QDC2|MGC105127
Gene Description family with sequence similarity 132, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM132A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388581
Iso type IgG

Enviar un mensaje


FAM132A polyclonal antibody

FAM132A polyclonal antibody