Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
WIPF2 polyclonal antibody
Abnova
WIPF2 polyclonal antibody
Ref: AB-PAB21634
WIPF2 polyclonal antibody
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against recombinant WIPF2.
Información adicional
Size
100 uL
Gene Name
WIPF2
Gene Alias
WICH|WIRE
Gene Description
WAS/WASL interacting protein family, member 2
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
WB,IHC-P
Immunogen Prot. Seq
MQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPP
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human WIPF2.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
147179
Iso type
IgG
Enviar un mensaje
WIPF2 polyclonal antibody
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*