NFKB2 polyclonal antibody
  • NFKB2 polyclonal antibody

NFKB2 polyclonal antibody

Ref: AB-PAB21621
NFKB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NFKB2.
Información adicional
Size 100 uL
Gene Name NFKB2
Gene Alias LYT-10|LYT10
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NFKB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4791
Iso type IgG

Enviar un mensaje


NFKB2 polyclonal antibody

NFKB2 polyclonal antibody