FAM154A polyclonal antibody
  • FAM154A polyclonal antibody

FAM154A polyclonal antibody

Ref: AB-PAB21620
FAM154A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM154A.
Información adicional
Size 100 uL
Gene Name FAM154A
Gene Alias C9orf138|FLJ35283|MGC35182
Gene Description family with sequence similarity 154, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSENPNQRELEVLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM154A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158297
Iso type IgG

Enviar un mensaje


FAM154A polyclonal antibody

FAM154A polyclonal antibody