ZBTB34 polyclonal antibody
  • ZBTB34 polyclonal antibody

ZBTB34 polyclonal antibody

Ref: AB-PAB21619
ZBTB34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZBTB34.
Información adicional
Size 100 uL
Gene Name ZBTB34
Gene Alias FLJ22470|KIAA1993|MGC24652|RP11-106H5.1
Gene Description zinc finger and BTB domain containing 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZBTB34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 403341
Iso type IgG

Enviar un mensaje


ZBTB34 polyclonal antibody

ZBTB34 polyclonal antibody