TMEM245 polyclonal antibody
  • TMEM245 polyclonal antibody

TMEM245 polyclonal antibody

Ref: AB-PAB21618
TMEM245 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM245.
Información adicional
Size 100 uL
Gene Name TMEM245
Gene Alias RP11-115J22.3|C9orf5|CG-2|CG2
Gene Description transmembrane protein 245
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AELPGQVISMAASTLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM245.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23731
Iso type IgG

Enviar un mensaje


TMEM245 polyclonal antibody

TMEM245 polyclonal antibody