MYO1E polyclonal antibody
  • MYO1E polyclonal antibody

MYO1E polyclonal antibody

Ref: AB-PAB21617
MYO1E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO1E.
Información adicional
Size 100 uL
Gene Name MYO1E
Gene Alias HuncM-IC|MGC104638|MYO1C
Gene Description myosin IE
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO1E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4643
Iso type IgG

Enviar un mensaje


MYO1E polyclonal antibody

MYO1E polyclonal antibody