FAT1 polyclonal antibody
  • FAT1 polyclonal antibody

FAT1 polyclonal antibody

Ref: AB-PAB21615
FAT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAT1.
Información adicional
Size 100 uL
Gene Name FAT1
Gene Alias CDHF7|FAT|ME5|hFat1
Gene Description FAT tumor suppressor homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2195
Iso type IgG

Enviar un mensaje


FAT1 polyclonal antibody

FAT1 polyclonal antibody