AFMID polyclonal antibody
  • AFMID polyclonal antibody

AFMID polyclonal antibody

Ref: AB-PAB21612
AFMID polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AFMID.
Información adicional
Size 100 uL
Gene Name AFMID
Gene Alias DKFZp686F03259|KF|MGC167063
Gene Description arylformamidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AFMID.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 125061
Iso type IgG

Enviar un mensaje


AFMID polyclonal antibody

AFMID polyclonal antibody