RUNDC1 polyclonal antibody
  • RUNDC1 polyclonal antibody

RUNDC1 polyclonal antibody

Ref: AB-PAB21602
RUNDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RUNDC1.
Información adicional
Size 100 uL
Gene Name RUNDC1
Gene Alias DKFZp761H0421
Gene Description RUN domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VSQFGCATGQIPPTLWQRVQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RUNDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146923
Iso type IgG

Enviar un mensaje


RUNDC1 polyclonal antibody

RUNDC1 polyclonal antibody