C8B polyclonal antibody
  • C8B polyclonal antibody

C8B polyclonal antibody

Ref: AB-PAB21600
C8B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8B.
Información adicional
Size 100 uL
Gene Name C8B
Gene Alias MGC163447
Gene Description complement component 8, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 732
Iso type IgG

Enviar un mensaje


C8B polyclonal antibody

C8B polyclonal antibody