ZC3H3 polyclonal antibody
  • ZC3H3 polyclonal antibody

ZC3H3 polyclonal antibody

Ref: AB-PAB21597
ZC3H3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZC3H3.
Información adicional
Size 100 uL
Gene Name ZC3H3
Gene Alias KIAA0150|ZC3HDC3
Gene Description zinc finger CCCH-type containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVGAGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZC3H3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23144
Iso type IgG

Enviar un mensaje


ZC3H3 polyclonal antibody

ZC3H3 polyclonal antibody