TATDN1 polyclonal antibody
  • TATDN1 polyclonal antibody

TATDN1 polyclonal antibody

Ref: AB-PAB21595
TATDN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TATDN1.
Información adicional
Size 100 uL
Gene Name TATDN1
Gene Alias CDA11
Gene Description TatD DNase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TATDN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83940
Iso type IgG

Enviar un mensaje


TATDN1 polyclonal antibody

TATDN1 polyclonal antibody