ZNF160 polyclonal antibody
  • ZNF160 polyclonal antibody

ZNF160 polyclonal antibody

Ref: AB-PAB21594
ZNF160 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF160.
Información adicional
Size 100 uL
Gene Name ZNF160
Gene Alias DKFZp686B16128|F11|FLJ00032|HKr18|HZF5|KIAA1611|KR18
Gene Description zinc finger protein 160
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTRECVKGVVTDIPPKCTIKDLLPKEKSSTEAVFHTVVLERHESPDIEDFSFKEPQKNVHDFECQWRDDTGNYKGVLMAQKEGKRDQRDRRDIENKLMNNQLGVSFHSHLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF160.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90338
Iso type IgG

Enviar un mensaje


ZNF160 polyclonal antibody

ZNF160 polyclonal antibody