B3GNTL1 polyclonal antibody Ver mas grande

B3GNTL1 polyclonal antibody

AB-PAB21590

Producto nuevo

B3GNTL1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name B3GNTL1
Gene Alias B3GNT8|MGC126253|MGC126256
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B3GNTL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146712
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant B3GNTL1.

Consulta sobre un producto

B3GNTL1 polyclonal antibody

B3GNTL1 polyclonal antibody