B3GNTL1 polyclonal antibody
  • B3GNTL1 polyclonal antibody

B3GNTL1 polyclonal antibody

Ref: AB-PAB21590
B3GNTL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant B3GNTL1.
Información adicional
Size 100 uL
Gene Name B3GNTL1
Gene Alias B3GNT8|MGC126253|MGC126256
Gene Description UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B3GNTL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146712
Iso type IgG

Enviar un mensaje


B3GNTL1 polyclonal antibody

B3GNTL1 polyclonal antibody