AP1GBP1 polyclonal antibody Ver mas grande

AP1GBP1 polyclonal antibody

AB-PAB21587

Producto nuevo

AP1GBP1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name AP1GBP1
Gene Alias MGC104959|SYNG
Gene Description AP1 gamma subunit binding protein 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QQQGFPMVSVMQPNMQGIMGMNYSSQMSQGPIAMQAGIPMGPMPAAGMPYLGQAPFLGMRPPGPQYTPDMQKQFAEEQQKRFEQQQKLLEEERKRRQFEEQKQKLRLLSSVKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP1GBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11276
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant AP1GBP1.

Consulta sobre un producto

AP1GBP1 polyclonal antibody

AP1GBP1 polyclonal antibody