AP1GBP1 polyclonal antibody
  • AP1GBP1 polyclonal antibody

AP1GBP1 polyclonal antibody

Ref: AB-PAB21586
AP1GBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AP1GBP1.
Información adicional
Size 100 uL
Gene Name AP1GBP1
Gene Alias MGC104959|SYNG
Gene Description AP1 gamma subunit binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FMAFSNSSISSEQKPDDKYDALKEEASPVPLTSNVGSTVKGGQNSTAASTKYDVFRQLSLEGSGLGVEDLKDNTPSGKSDDDFADFHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP1GBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11276
Iso type IgG

Enviar un mensaje


AP1GBP1 polyclonal antibody

AP1GBP1 polyclonal antibody