EFCAB1 polyclonal antibody
  • EFCAB1 polyclonal antibody

EFCAB1 polyclonal antibody

Ref: AB-PAB21584
EFCAB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EFCAB1.
Información adicional
Size 100 uL
Gene Name EFCAB1
Gene Alias FLJ11767
Gene Description EF-hand calcium binding domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq YCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EFCAB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79645
Iso type IgG

Enviar un mensaje


EFCAB1 polyclonal antibody

EFCAB1 polyclonal antibody