AGAP2 polyclonal antibody
  • AGAP2 polyclonal antibody

AGAP2 polyclonal antibody

Ref: AB-PAB21576
AGAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AGAP2.
Información adicional
Size 100 uL
Gene Name AGAP2
Gene Alias CENTG1|FLJ16430|GGAP2|KIAA0167|PIKE
Gene Description ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AGAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116986
Iso type IgG

Enviar un mensaje


AGAP2 polyclonal antibody

AGAP2 polyclonal antibody