ZNF347 polyclonal antibody
  • ZNF347 polyclonal antibody

ZNF347 polyclonal antibody

Ref: AB-PAB21573
ZNF347 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF347.
Información adicional
Size 100 uL
Gene Name ZNF347
Gene Alias ZNF1111
Gene Description zinc finger protein 347
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF347.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84671
Iso type IgG

Enviar un mensaje


ZNF347 polyclonal antibody

ZNF347 polyclonal antibody