GLT6D1 polyclonal antibody
  • GLT6D1 polyclonal antibody

GLT6D1 polyclonal antibody

Ref: AB-PAB21571
GLT6D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLT6D1.
Información adicional
Size 100 uL
Gene Name GLT6D1
Gene Alias GLTDC1
Gene Description glycosyltransferase 6 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLT6D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 360203
Iso type IgG

Enviar un mensaje


GLT6D1 polyclonal antibody

GLT6D1 polyclonal antibody