ZNF324B polyclonal antibody
  • ZNF324B polyclonal antibody

ZNF324B polyclonal antibody

Ref: AB-PAB21569
ZNF324B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF324B.
Información adicional
Size 100 uL
Gene Name ZNF324B
Gene Alias FLJ45850
Gene Description zinc finger protein 324B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF324B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388569
Iso type IgG

Enviar un mensaje


ZNF324B polyclonal antibody

ZNF324B polyclonal antibody