ZNF77 polyclonal antibody
  • ZNF77 polyclonal antibody

ZNF77 polyclonal antibody

Ref: AB-PAB21568
ZNF77 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF77.
Información adicional
Size 100 uL
Gene Name ZNF77
Gene Alias pT1
Gene Description zinc finger protein 77
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF77.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58492
Iso type IgG

Enviar un mensaje


ZNF77 polyclonal antibody

ZNF77 polyclonal antibody