GSDMA polyclonal antibody
  • GSDMA polyclonal antibody

GSDMA polyclonal antibody

Ref: AB-PAB21557
GSDMA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GSDMA.
Información adicional
Size 100 uL
Gene Name GSDMA
Gene Alias FKSG9|FLJ39120|GSDM|GSDM1|MGC129596
Gene Description gasdermin A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GSDMA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284110
Iso type IgG

Enviar un mensaje


GSDMA polyclonal antibody

GSDMA polyclonal antibody