AMZ2 polyclonal antibody
  • AMZ2 polyclonal antibody

AMZ2 polyclonal antibody

Ref: AB-PAB21554
AMZ2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AMZ2.
Información adicional
Size 100 uL
Gene Name AMZ2
Gene Alias -
Gene Description archaelysin family metallopeptidase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AMZ2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51321
Iso type IgG

Enviar un mensaje


AMZ2 polyclonal antibody

AMZ2 polyclonal antibody