C8orf55 polyclonal antibody
  • C8orf55 polyclonal antibody

C8orf55 polyclonal antibody

Ref: AB-PAB21546
C8orf55 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8orf55.
Información adicional
Size 100 uL
Gene Name C8orf55
Gene Alias DSCD75
Gene Description chromosome 8 open reading frame 55
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8orf55.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51337
Iso type IgG

Enviar un mensaje


C8orf55 polyclonal antibody

C8orf55 polyclonal antibody