ZNF341 polyclonal antibody
  • ZNF341 polyclonal antibody

ZNF341 polyclonal antibody

Ref: AB-PAB21545
ZNF341 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF341.
Información adicional
Size 100 uL
Gene Name ZNF341
Gene Alias -
Gene Description zinc finger protein 341
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PYPPLEVPNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGARGLPEAAGKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF341.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84905
Iso type IgG

Enviar un mensaje


ZNF341 polyclonal antibody

ZNF341 polyclonal antibody