NUDCD1 polyclonal antibody
  • NUDCD1 polyclonal antibody

NUDCD1 polyclonal antibody

Ref: AB-PAB21544
NUDCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUDCD1.
Información adicional
Size 100 uL
Gene Name NUDCD1
Gene Alias CML66|FLJ14991
Gene Description NudC domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUDCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84955
Iso type IgG

Enviar un mensaje


NUDCD1 polyclonal antibody

NUDCD1 polyclonal antibody