SLC45A4 polyclonal antibody
  • SLC45A4 polyclonal antibody

SLC45A4 polyclonal antibody

Ref: AB-PAB21541
SLC45A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC45A4.
Información adicional
Size 100 uL
Gene Name SLC45A4
Gene Alias KIAA1126
Gene Description solute carrier family 45, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETERLQVLTSVRSRHIGWCR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC45A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57210
Iso type IgG

Enviar un mensaje


SLC45A4 polyclonal antibody

SLC45A4 polyclonal antibody