ZBTB2 polyclonal antibody Ver mas grande

ZBTB2 polyclonal antibody

AB-PAB21538

Producto nuevo

ZBTB2 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name ZBTB2
Gene Alias ZNF437
Gene Description zinc finger and BTB domain containing 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TGVPFTSSQQGESRVPLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKRRKYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZBTB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57621
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant ZBTB2.

Consulta sobre un producto

ZBTB2 polyclonal antibody

ZBTB2 polyclonal antibody