C17orf28 polyclonal antibody
  • C17orf28 polyclonal antibody

C17orf28 polyclonal antibody

Ref: AB-PAB21533
C17orf28 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C17orf28.
Información adicional
Size 100 uL
Gene Name C17orf28
Gene Alias DMC1|FLJ43526
Gene Description chromosome 17 open reading frame 28
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf28.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283987
Iso type IgG

Enviar un mensaje


C17orf28 polyclonal antibody

C17orf28 polyclonal antibody