KIAA0753 polyclonal antibody
  • KIAA0753 polyclonal antibody

KIAA0753 polyclonal antibody

Ref: AB-PAB21528
KIAA0753 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0753.
Información adicional
Size 100 uL
Gene Name KIAA0753
Gene Alias MGC130040|MGC130041
Gene Description KIAA0753
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PCNGNSLDESVGTEEGSEKREAPLLSLAEDSQQKEGRAPLFVPPGMQHSIGDYCSRFEQYLRIISHEAVGSFNPWLIAESFSEELVDEALGAVAAELQDMCEDYAEAVFTSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0753.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9851
Iso type IgG

Enviar un mensaje


KIAA0753 polyclonal antibody

KIAA0753 polyclonal antibody