ZNF521 polyclonal antibody
  • ZNF521 polyclonal antibody

ZNF521 polyclonal antibody

Ref: AB-PAB21527
ZNF521 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF521.
Información adicional
Size 100 uL
Gene Name ZNF521
Gene Alias DKFZp564D0764|EHZF|Evi3|MGC142182|MGC142208
Gene Description zinc finger protein 521
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KQDLVKLDINGLPYGLCAGCVNLSKSASPGINVPPGTNRPGLGQNENLSAIEGKGKVGGLKTRCSSCNVKFESE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF521.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25925
Iso type IgG

Enviar un mensaje


ZNF521 polyclonal antibody

ZNF521 polyclonal antibody