SLC25A10 polyclonal antibody
  • SLC25A10 polyclonal antibody

SLC25A10 polyclonal antibody

Ref: AB-PAB21526
SLC25A10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A10.
Información adicional
Size 100 uL
Gene Name SLC25A10
Gene Alias DIC
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1468
Iso type IgG

Enviar un mensaje


SLC25A10 polyclonal antibody

SLC25A10 polyclonal antibody