C17orf53 polyclonal antibody Ver mas grande

C17orf53 polyclonal antibody

AB-PAB21517

Producto nuevo

C17orf53 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name C17orf53
Gene Alias FLJ11594|MGC3130
Gene Description chromosome 17 open reading frame 53
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 78995
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant C17orf53.

Consulta sobre un producto

C17orf53 polyclonal antibody

C17orf53 polyclonal antibody