C17orf53 polyclonal antibody
  • C17orf53 polyclonal antibody

C17orf53 polyclonal antibody

Ref: AB-PAB21517
C17orf53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C17orf53.
Información adicional
Size 100 uL
Gene Name C17orf53
Gene Alias FLJ11594|MGC3130
Gene Description chromosome 17 open reading frame 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 78995
Iso type IgG

Enviar un mensaje


C17orf53 polyclonal antibody

C17orf53 polyclonal antibody