TXNDC17 polyclonal antibody
  • TXNDC17 polyclonal antibody

TXNDC17 polyclonal antibody

Ref: AB-PAB21514
TXNDC17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC17.
Información adicional
Size 100 uL
Gene Name TXNDC17
Gene Alias MGC14353|TRP14|TXNL5
Gene Description thioredoxin domain containing 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84817
Iso type IgG

Enviar un mensaje


TXNDC17 polyclonal antibody

TXNDC17 polyclonal antibody