ZNF800 polyclonal antibody
  • ZNF800 polyclonal antibody

ZNF800 polyclonal antibody

Ref: AB-PAB21502
ZNF800 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF800.
Información adicional
Size 100 uL
Gene Name ZNF800
Gene Alias FLJ43301|MGC130032|MGC130033
Gene Description zinc finger protein 800
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PIETNQNAVFQYISRTDNPIEVTESSSTPEQTEVQIQETSTEQSKTVPVTDTEVETVEPPPVEIVTDEVAPTSDEQPQESQADLETSDNSDFGHQLICCLCRKEFNSRRGVRRHIRKVHKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF800.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168850
Iso type IgG

Enviar un mensaje


ZNF800 polyclonal antibody

ZNF800 polyclonal antibody