ANKFN1 polyclonal antibody
  • ANKFN1 polyclonal antibody

ANKFN1 polyclonal antibody

Ref: AB-PAB21501
ANKFN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKFN1.
Información adicional
Size 100 uL
Gene Name ANKFN1
Gene Alias FLJ38335
Gene Description ankyrin-repeat and fibronectin type III domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKFN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162282
Iso type IgG

Enviar un mensaje


ANKFN1 polyclonal antibody

ANKFN1 polyclonal antibody