RSAD1 polyclonal antibody
  • RSAD1 polyclonal antibody

RSAD1 polyclonal antibody

Ref: AB-PAB21496
RSAD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSAD1.
Información adicional
Size 100 uL
Gene Name RSAD1
Gene Alias FLJ11164|FLJ20975
Gene Description radical S-adenosyl methionine domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLLLTLLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSAD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55316
Iso type IgG

Enviar un mensaje


RSAD1 polyclonal antibody

RSAD1 polyclonal antibody