MAP1B polyclonal antibody
  • MAP1B polyclonal antibody

MAP1B polyclonal antibody

Ref: AB-PAB21488
MAP1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP1B.
Información adicional
Size 100 uL
Gene Name MAP1B
Gene Alias DKFZp686E1099|DKFZp686F1345|FLJ38954|FUTSCH|MAP5
Gene Description microtubule-associated protein 1B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4131
Iso type IgG

Enviar un mensaje


MAP1B polyclonal antibody

MAP1B polyclonal antibody