MAP1B polyclonal antibody Ver mas grande

MAP1B polyclonal antibody

AB-PAB21488

Producto nuevo

MAP1B polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name MAP1B
Gene Alias DKFZp686E1099|DKFZp686F1345|FLJ38954|FUTSCH|MAP5
Gene Description microtubule-associated protein 1B
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4131
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant MAP1B.

Consulta sobre un producto

MAP1B polyclonal antibody

MAP1B polyclonal antibody