LPCAT1 polyclonal antibody
  • LPCAT1 polyclonal antibody

LPCAT1 polyclonal antibody

Ref: AB-PAB21485
LPCAT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LPCAT1.
Información adicional
Size 100 uL
Gene Name LPCAT1
Gene Alias AYTL2|FLJ12443|FLJ41609|PFAAP3|lpcat
Gene Description lysophosphatidylcholine acyltransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LPCAT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79888
Iso type IgG

Enviar un mensaje


LPCAT1 polyclonal antibody

LPCAT1 polyclonal antibody