Ver mas grande
EFTUD2 polyclonal antibody
AB-PAB21470
Producto nuevo
EFTUD2 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | EFTUD2 |
| Gene Alias | DKFZp686E24196|FLJ44695|KIAA0031|Snrp116|Snu114|U5-116KD |
| Gene Description | elongation factor Tu GTP binding domain containing 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P,IF |
| Immunogen Prot. Seq | DDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPV |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:200-1:500)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human EFTUD2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 9343 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant EFTUD2.