EFTUD2 polyclonal antibody
  • EFTUD2 polyclonal antibody

EFTUD2 polyclonal antibody

Ref: AB-PAB21470
EFTUD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EFTUD2.
Información adicional
Size 100 uL
Gene Name EFTUD2
Gene Alias DKFZp686E24196|FLJ44695|KIAA0031|Snrp116|Snu114|U5-116KD
Gene Description elongation factor Tu GTP binding domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EFTUD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9343
Iso type IgG

Enviar un mensaje


EFTUD2 polyclonal antibody

EFTUD2 polyclonal antibody